Recombinant Fruit Fly RPS3 Protein (1-246 aa), His-tagged

• Cat.No.: RPS3-2481F
• Product Overview: Recombinant Fruit Fly (Drosophila melanogaster) RPS3 Protein (1-246 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length.

Specification

• Description: Has DNA repair activity directed towards the mutagenic lesions 8-oxoguanine and abasic sites in DNA. It can cleave DNA containing 8-oxoguanine residues efficiently. Also acts as an ap lyase, cleaving phosphodiester bonds via a beta,delta elimination reaction.
• Source: E. coli
• Species: Fruit Fly
• Tag: His
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 31.5 kDa
• Protein length: 1-246 aa
• AA Sequence: MNANLPISKKRKFVSDGIFKAELNEFLTRELAEDGYSGVEVRVTPSRTEIIIMATKTQQVLGEKGRRIRELTAMVQKRFNFETGRIELYAEKVAARGLCAIAQAESLRYKLTGGLAVRRACYGVLRYIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPCNDYVETATRHVLLRQGVLGIKVKVMLPYDPKNKIGPKKPLPDNVSVVEPKEEKIYETPETEYKIPPPSKPLDDLSEAKVL
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: RpS3 Ribosomal protein S3 [ Drosophila melanogaster (fruit fly) ]
• Official Symbol: RPS3
• Synonyms: RpS3; 6779; CG6779; chr3R:19185518..19185701; Dmel\CG6779; DmRpS3; dS3; IP15838p; M; M(3)124; M(3)95A; M(3)B; M(3)B2; M(3)Fla; M(3)w; M(3R)w; M95A; Mw; M[[w]]; Rp S3; rps3; rpS3; Rps3; RPS3; RS3; S3; X72921
• Gene ID: 42761
• mRNA Refseq: NM_001300552
• Protein Refseq: NP_001287481
• UniProt ID: Q06559