Recombinant Human RPS27 protein, GST-tagged

• Cat.No.: RPS27-3449H
• Product Overview: Recombinant Human RPS27 protein(P42677)(1-84aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 36.3 kDa
• Protein length: 1-84aa
• AA Sequence: PLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: RPS27 ribosomal protein S27 [ Homo sapiens ]
• Official Symbol: RPS27
• Synonyms: RPS27; ribosomal protein S27; ribosomal protein S27 (metallopanstimulin 1); 40S ribosomal protein S27; metallopanstimulin 1; MPS 1; MPS1; S27; metallopan-stimulin 1; MPS-1
• Gene ID: 6232
• mRNA Refseq: NM_001030
• Protein Refseq: NP_001021
• MIM: 603702
• UniProt ID: P42677