Recombinant Human RPS19BP1 protein, His-tagged

• Cat.No.: RPS19BP1-2421H
• Product Overview: Recombinant Human RPS19BP1 protein(1-136 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: N-His
• Protein length: 1-136 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: MSAALLRRGLELLAASEAPRDPPGQAKPRGAPVKRPRKTKAIQAQKLRNSAKGKVPKSALDEYRKRECRDHLRVNLKFLTRTRSTVAESVSQQILRQNRGRKACDRPVAKTKKKKAEGTVFTEEDFQKFQQEYFGS
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: RPS19BP1 ribosomal protein S19 binding protein 1 [ Homo sapiens ]
• Official Symbol: RPS19BP1
• Synonyms: RPS19BP1; ribosomal protein S19 binding protein 1; active regulator of SIRT1; FLJ21770; MGC52010; RPS19-binding protein 1; homolog of mouse S19 binding protein; 40S ribosomal protein S19-binding protein 1; AROS; S19BP; dJ1104E15.4
• Gene ID: 91582
• mRNA Refseq: NM_194326
• Protein Refseq: NP_919307
• MIM: 610225
• UniProt ID: Q86WX3