Recombinant Human RPS13 protein(61-140 aa), C-His-tagged
Cat.No. : | RPS13-2802H |
Product Overview : | Recombinant Human RPS13 protein(P62277)(61-140 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 61-140 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | AQVRFVTGNKILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERNRKDKDAKFRLILIESRIHRLARYYKTKRVLPPNWK |
Gene Name | RPS13 ribosomal protein S13 [ Homo sapiens ] |
Official Symbol | RPS13 |
Synonyms | RPS13; ribosomal protein S13; 40S ribosomal protein S13; S13; |
Gene ID | 6207 |
mRNA Refseq | NM_001017 |
Protein Refseq | NP_001008 |
MIM | 180476 |
UniProt ID | P62277 |
◆ Recombinant Proteins | ||
RPS13-2415H | Recombinant Human RPS13, GST-tagged | +Inquiry |
RPS13-4012R | Recombinant Rhesus monkey RPS13 Protein, His-tagged | +Inquiry |
RPS13-2802H | Recombinant Human RPS13 protein(61-140 aa), C-His-tagged | +Inquiry |
RPS13-3829R | Recombinant Rhesus Macaque RPS13 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPS13-564H | Recombinant Human ribosomal protein S13, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPS13-558HCL | Recombinant Human RPS13 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RPS13 Products
Required fields are marked with *
My Review for All RPS13 Products
Required fields are marked with *
0
Inquiry Basket