Recombinant Human RPP38 protein(41-120 aa), C-His-tagged

• Cat.No.: RPP38-2807H
• Product Overview: Recombinant Human RPP38 protein(P78345)(41-120 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 41-120 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: MHFILQTLEDRLKAIGLQKIEDKKKKNKTPFLKKESREKCSIAVDISENLKEKKTDAKQQVSGWTPAHVRKQLAIGVNEV

Gene Information

• Gene Name: RPP38 ribonuclease P/MRP 38kDa subunit [ Homo sapiens ]
• Official Symbol: RPP38
• Synonyms: RPP38; ribonuclease P/MRP 38kDa subunit; ribonuclease P protein subunit p38; RNaseP protein p38; ribonuclease P (38kD) (RPP38); RP11-455B2.5
• Gene ID: 10557
• mRNA Refseq: NM_001097590
• Protein Refseq: NP_001091059
• MIM: 606116
• UniProt ID: P78345