Recombinant Human RPP38-DT Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RPP38-DT-1832H
• Product Overview: C10orf111 MS Standard C13 and N15-labeled recombinant protein (NP_694976) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: RPP38-DT (RPP38 Divergent Transcript) is an RNA Gene, and is affiliated with the lncRNA class.
• Molecular Mass: 17.8 kDa
• AA Sequence: MESLQTPQHRENQDKREKEYGVKHMPMGNNAGNLEPEKRKAVRVALSSATAAQNIPSSVHCGCSKQWRLRLPSESLQSRGQVMKRPNNILKLRNLDLLIYPWPELRRRQVASDLMSLLLLPAFSGLTWAPFLFLFTYLPPFLNLLTVGFVSYFLVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RPP38-DT RPP38 divergent transcript [ Homo sapiens (human) ]
• Official Symbol: RPP38-DT
• Synonyms: RPP38-DT; RPP38 divergent transcript; C10orf111
• Gene ID: 221060
• mRNA Refseq: NM_153244
• Protein Refseq: NP_694976
• UniProt ID: Q8N326