Recombinant Human RPL11 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RPL11-6134H
Product Overview : RPL11 MS Standard C13 and N15-labeled recombinant protein (NP_000966) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L5P family of ribosomal proteins. It is located in the cytoplasm. The protein probably associates with the 5S rRNA. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Source : HEK293
Species : Human
Tag : Myc&DDK
Molecular Mass : 20.1 kDa
AA Sequence : MADQGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSFGIRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRPGFSIADKKRRTGCIGAKHRISKEEAMRWFQQKYDGIILPGKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RPL11 ribosomal protein L11 [ Homo sapiens (human) ]
Official Symbol RPL11
Synonyms RPL11; ribosomal protein L11; 60S ribosomal protein L11; L11; CLL-associated antigen KW-12; cell growth-inhibiting protein 34; DBA7; GIG34;
Gene ID 6135
mRNA Refseq NM_000975
Protein Refseq NP_000966
MIM 604175
UniProt ID P62913

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RPL11 Products

Required fields are marked with *

My Review for All RPL11 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon