Recombinant Human RPF2 Protein, GST-tagged

• Cat.No.: RPF2-406H
• Product Overview: Human BXDC1 full-length ORF ( NP_115570.1, 1 a.a. - 306 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 62 kDa
• AA Sequence: MDTLDRVVKPKTKRAKRFLEKREPKLNENIKNAMLIKGGNANATVTKVLKDVYALKKPYGVLYKKKNITRPFEDQTSLEFFSKKSDCSLFMFGSHNKKRPNNLVIGRMYDYHVLDMIELGIENFVSLKDIKNSKCPEGTKPMLIFAGDDFDVTEDYRRLKSLLIDFFRGPTVSNIRLAGLEYVLHFTALNGKIYFRSYKLLLKKSGCRTPRIELEEMGPSLDLVLRRTHLASDDLYKLSMKMPKALKPKKKKNISHDTFGTTYGRIHMQKQDLSKLQTRKMKGLKKRPAERITEDHEKKSKRIKKN
• Quality Control Test: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: RPF2 ribosome production factor 2 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: RPF2
• Synonyms: RPF2; ribosome production factor 2 homolog (S. cerevisiae); brix domain containing 1 , BXDC1; ribosome production factor 2 homolog; bA397G5.4; FLJ21087; ribosomal processing factor 2 homolog (S. cerevisiae); homolog of Rpf2; brix domain containing 1; brix domain-containing protein 1; ribosomal processing factor 2 homolog; ribosome biogenesis protein RPF2 homolog; BXDC1
• Gene ID: 84154
• mRNA Refseq: NM_032194
• Protein Refseq: NP_115570
• UniProt ID: Q9H7B2