Recombinant Human RPA3 protein, His-tagged

• Cat.No.: RPA3-3441H
• Product Overview: Recombinant Human RPA3 protein(P35244)(1-119aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 1-119aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 17.3 kDa
• AA Sequence: MVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQ
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: RPA3 replication protein A3, 14kDa [ Homo sapiens ]
• Official Symbol: RPA3
• Synonyms: RPA3; replication protein A3, 14kDa; replication protein A3 (14kD); replication protein A 14 kDa subunit; REPA3; RP-A p14; RF-A protein 3; replication factor A protein 3
• Gene ID: 6119
• mRNA Refseq: NM_002947
• Protein Refseq: NP_002938
• MIM: 179837
• UniProt ID: P35244