Recombinant Human ROR1 protein, T7/His-tagged

• Cat.No.: ROR1-88H
• Product Overview: Recombinant human ROR1 extracellular domain cDNA (30-406 aa) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 30-406 a.a.
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose, DTT.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGEFQETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAE LHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFG PPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPS LCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGI PMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFT LDENFKSDLCDIPACDSKDSKEKNKMEILY
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro ROR1 mediated T cell and neuronal cell differentiation regulation study with this protein either as soluble factor or as coating matrix protein.2. May be used for protein-protein interaction assay.3. Potential biomarker protein for cancer therapy applications.4. As antigen for specific antibody production.
• Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.

Gene Information

• Gene Name: ROR1 receptor tyrosine kinase-like orphan receptor 1 [ Homo sapiens ]
• Official Symbol: ROR1
• Synonyms: ROR1; receptor tyrosine kinase-like orphan receptor 1; NTRKR1; tyrosine-protein kinase transmembrane receptor ROR1; neurotrophic tyrosine kinase receptor-related 1; neurotrophic tyrosine kinase, receptor-related 1; dJ537F10.1; MGC99659
• Gene ID: 4919
• mRNA Refseq: NM_001083592
• Protein Refseq: NP_001077061
• MIM: 602336
• UniProt ID: Q01973
• Chromosome Location: 1p32-p31
• Pathway: Nuclear Receptors, organism-specific biosystem
• Function: ATP binding; Wnt-protein binding; kinase activity; nucleotide binding; receptor activity; transmembrane receptor protein tyrosine kinase activity