Recombinant Human RNPS1 protein, T7-tagged

• Cat.No.: RNPS1-179H
• Product Overview: Recombinant human RNPS1 (305 aa) protein fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: T7
• Protein Length: 305 a.a.
• Form: 0.1 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGEFMDLSGVKKKSLLGVKENNKKSSTRAPSPTKRKDRSDEKSKDRSKDKGATKESSEKDRGRD KTRKRRSASSGSSSTRSRSSSTSSSGSSTSTGSSSGSSSSSASSRSGSSSTSRSSSSSSSSGSPSPSRRRHDNRR RSRSKSKPPKRDEKERKRRSPSPKPTKVHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEF ENPDEAEKALKHMDGGQIDGQEITATAVLAPWPRPPPRRFSPPRRMLPPPPMWRRSPPRMRRRSRSPRRRSPVRR RSRSPGRRRHRSRSSSNSSR
• Purity: >90% by SDS-PAGE.
• Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.

Gene Information

• Gene Name: RNPS1 RNA binding protein S1, serine-rich domain [ Homo sapiens ]
• Official Symbol: RNPS1
• Synonyms: RNPS1; SR protein; SR-related protein LDC2; RNA-binding protein S1, serine-rich domain; E5.1; MGC117332
• Gene ID: 10921
• mRNA Refseq: NM_006711
• Protein Refseq: NP_006702
• MIM: 606447
• UniProt ID: Q15287
• Chromosome Location: 16p13.3
• Pathway: Cleavage of Growing Transcript in the Termination Region, organism-specific biosystem; Exon junction complex (EJC), organism-specific biosystem; Gene Expression, organism-specific biosystem; Nonsense Mediated Decay Enhanced by the Exon Junction Complex, organism-specific biosystem; Nonsense-Mediated Decay, organism-specific biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; RNA Polymerase II Transcription, organism-specific biosystem
• Function: RNA binding; mRNA 3-UTR binding; nucleotide binding; protein binding