Recombinant Human RNPEP
Cat.No. : | RNPEP-30435TH |
Product Overview : | Recombinant fragment Human RNPEP with N-terminal proprietary tag. Predicted MW 36.63kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | Aminopeptidase B is an enzyme that in humans is encoded by the RNPEP gene. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GNVKKLGDTYPSISNARNAELRLRWGQIVLKNDHQEDFWKVKEFLHNQGKQKYTLPLYHAMMGGSEVAQTLAKETFASTASQLHSNVVNYVQQIVAPKGS |
Sequence Similarities : | Belongs to the peptidase M1 family. |
Gene Name | RNPEP arginyl aminopeptidase (aminopeptidase B) [ Homo sapiens ] |
Official Symbol | RNPEP |
Synonyms | RNPEP; arginyl aminopeptidase (aminopeptidase B); aminopeptidase B; |
Gene ID | 6051 |
mRNA Refseq | NM_020216 |
Protein Refseq | NP_064601 |
MIM | 602675 |
Uniprot ID | Q9H4A4 |
Chromosome Location | 1q32 |
Function | aminopeptidase activity; aminopeptidase activity; cobalt ion binding; copper ion binding; epoxide hydrolase activity; |
◆ Recombinant Proteins | ||
RNPEP-30435TH | Recombinant Human RNPEP | +Inquiry |
Rnpep-3426R | Recombinant Rat Rnpep, His-tagged | +Inquiry |
Rnpep-5563M | Recombinant Full Length Mouse Rnpep Protein, Myc/DDK-tagged | +Inquiry |
RNPEP-5090R | Recombinant Rat RNPEP Protein | +Inquiry |
RNPEP-2353H | Recombinant Human RNPEP, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNPEP-1531HCL | Recombinant Human RNPEP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RNPEP Products
Required fields are marked with *
My Review for All RNPEP Products
Required fields are marked with *
0
Inquiry Basket