Recombinant Human RNMT protein, His-tagged

• Cat.No.: RNMT-3531H
• Product Overview: Recombinant Human RNMT protein(128-476 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 128-476 aa
• AA Sequence: KIALEDVPEKQKNLEEGHSSTVAAHYNELQEVGLEKRSQSRIFYLRNFNNWMKSVLIGEFLEKVRQKKKRDITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRRDSEYIFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEGVVDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQALEPYPANESSKLVSEKVDDYEHAAKYMKNSQVRLPLGTLSKSEWEATSIYLVFAFEKQQ
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: RNMT RNA (guanine-7-) methyltransferase [ Homo sapiens ]
• Official Symbol: RNMT
• Synonyms: RNMT; RNA (guanine-7-) methyltransferase; mRNA cap guanine-N7 methyltransferase; RG7MT1; hMet; hCMT1; hcm1p; mRNA cap methyltransferase; mRNA (guanine-7-)methyltransferase; mRNA (guanine-N(7)-)-methyltransferase; MET; hCMT1c; KIAA0398; DKFZp686H1252
• Gene ID: 8731
• mRNA Refseq: NM_003799
• Protein Refseq: NP_003790
• MIM: 603514
• UniProt ID: O43148