Recombinant Human RNH1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RNH1-1313H
• Product Overview: RNH1 MS Standard C13 and N15-labeled recombinant protein (NP_976320) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Placental ribonuclease inhibitor (PRI) is a member of a family of proteinaceous cytoplasmic RNase inhibitors that occur in many tissues and bind to both intracellular and extracellular RNases. In addition to control of intracellular RNases, the inhibitor may have a role in the regulation of angiogenin. Ribonuclease inhibitor, of 50,000 Da, binds to ribonucleases and holds them in a latent form. Since neutral and alkaline ribonucleases probably play a critical role in the turnover of RNA in eukaryotic cells, RNH may be essential for control of mRNA turnover; the interaction of eukaryotic cells with ribonuclease may be reversible in vivo.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 50 kDa
• AA Sequence: Tags(s)X*AWTSRAWTSSVRS*ATLDGPSSSLCSSSAKWSGWTTVASRKHGARTSALHFESTLHWQSSTCAATSWAMSACIACSRACRPPPARSRS*ASRTAA*RGPAAGSCPAHYAPCPPCRSCTSATTSWGMRACSCSAKDSWTPSAAWKSCSWSIAASRLPAASPWPPCSGPSRTSRSSRLATTTSMRLASVCCARA*RTPPASWRRSSWRAAV*HQTTAGTCAALWPPRPRCGSWPWAATSWVMWAWRSCAQGCSTPAPGSGPCGSGSVASLPRAAGICAVSSGPRRA*RSSAWPATSWGMRVPDCCVRPCWNLAASWSRCG*SPAASQPPAAPTSAQCWPRTGFSWSYR*ATTGWRMRACGSCARAWASLALCCGCSGWPTAM*VTAAAAASPQPCWPTTACVSWTSATTAWGTPASCSWWRASGSRAASWSSWSCTTFTGLRRWRTGCRPWRRTSHP*GSSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RNH1 ribonuclease/angiogenin inhibitor 1 [ Homo sapiens (human) ]
• Official Symbol: RNH1
• Synonyms: RNH1; ribonuclease/angiogenin inhibitor 1; ribonuclease/angiogenin inhibitor, RNH; ribonuclease inhibitor; RAI; placental RNase inhibitor; placental ribonuclease inhibitor; RNH; MGC4569; MGC18200; MGC54054
• Gene ID: 6050
• mRNA Refseq: NM_203386
• Protein Refseq: NP_976320
• MIM: 173320
• UniProt ID: P13489