Recombinant Human RNF219 Protein, GST-tagged

• Cat.No.: RNF219-532H
• Product Overview: Human C13orf7 partial ORF ( NP_078822, 1 a.a. - 95 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.19 kDa
• AA Sequence: MLSHTVRKHLRKTRLELLHKEYEDEIDCLQKEVEELKSKNLSLESQIKTILDPLTLVQGNQNEDKHLVTDNPSKINPETVAEWKKKLRTANEIYE
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: RNF219 ring finger protein 219 [ Homo sapiens ]
• Official Symbol: RNF219
• Synonyms: RNF219; ring finger protein 219; C13orf7, chromosome 13 open reading frame 7; RING finger protein 219; FLJ13449; C13orf7; FLJ25774; DKFZp686A01276; DKFZp686N15250; DKFZp686O03173
• Gene ID: 79596
• mRNA Refseq: NM_024546
• Protein Refseq: NP_078822
• UniProt ID: Q5W0B1