Recombinant Human RNF214 Protein, GST-tagged

• Cat.No.: RNF214-2647H
• Product Overview: Human DKFZp547C195 partial ORF ( NP_997226, 541 a.a. - 640 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: RNF214 (Ring Finger Protein 214) is a Protein Coding gene. An important paralog of this gene is TTC3.
• Molecular Mass: 36.74 kDa
• AA Sequence: LAEHERVAASTQPLGRIRALFPAPLAQISTPMFLPSAQVSYPGRSSHAPATCKLCLMCQKLVQPSELHPMACTHVLHKECIKFWAQTNTNDTCPFCPTLK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: RNF214 ring finger protein 214 [ Homo sapiens ]
• Official Symbol: RNF214
• Synonyms: RNF214; ring finger protein 214; RING finger protein 214; DKFZp547C195
• Gene ID: 257160
• mRNA Refseq: NM_001077239
• Protein Refseq: NP_001070707
• UniProt ID: Q8ND24