Recombinant Human RNF207 Protein, GST-tagged

• Cat.No.: RNF207-4355H
• Product Overview: Human FLJ46380 full-length ORF ( ENSP00000344316, 1 a.a. - 244 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: RNF207 (Ring Finger Protein 207) is a Protein Coding gene. GO annotations related to this gene include ion channel binding and Hsp70 protein binding.
• Molecular Mass: 52.4 kDa
• AA Sequence: MSGAIFGPLEGPSSLDAPSIHPLVCPLCHVQYERPCLLDCFHDFCAGCLRGRATDGRLTCPLCQHQTVLKGPSGLPPVDRLLQFLVDSSGDGVEAVRCANCDLECSEQAGAAGRVGEEQRVPGCTVPNACTCTQHVFRGRPGSGFSSTSLGHLGPKCEPHYTGGETEVQNKGLEPVSRQWQRLRPFDLGRAHWSPIQGGVVDLHRRGSPVCRPGPTLKGLCYPSGIEAATAQGRWGQHAVPSGL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: RNF207 ring finger protein 207 [ Homo sapiens ]
• Official Symbol: RNF207
• Synonyms: RNF207; ring finger protein 207; C1orf188, chromosome 1 open reading frame 188; RING finger protein 207; FLJ32096; FLJ46380; OTTHUMG00000001089; C1orf188; FLJ46593
• Gene ID: 388591
• mRNA Refseq: NM_207396
• Protein Refseq: NP_997279
• MIM: 616923
• UniProt ID: Q6ZRF8