Recombinant Human RNF2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RNF2-5035H
• Product Overview: RNF2 MS Standard C13 and N15-labeled recombinant protein (NP_009143) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Polycomb group (PcG) of proteins form the multiprotein complexes that are important for the transcription repression of various genes involved in development and cell proliferation. The protein encoded by this gene is one of the PcG proteins. It has been shown to interact with, and suppress the activity of, transcription factor CP2 (TFCP2/CP2). Studies of the mouse counterpart suggested the involvement of this gene in the specification of anterior-posterior axis, as well as in cell proliferation in early development. This protein was also found to interact with huntingtin interacting protein 2 (HIP2), an ubiquitin-conjugating enzyme, and possess ubiquitin ligase activity.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 37.7 kDa
• AA Sequence: MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQYTIYIATASGQFTVLNGSFSLELVSEKYWKVNKPMELYYAPTKEHKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RNF2 ring finger protein 2 [ Homo sapiens (human) ]
• Official Symbol: RNF2
• Synonyms: RNF2; ring finger protein 2; E3 ubiquitin-protein ligase RING2; BAP 1; BAP1; DING; HIPI3; RING1B; RING2; protein DinG; RING finger protein 1B; RING finger protein BAP-1; HIP2-interacting protein 3; huntingtin-interacting protein 2-interacting protein 3; BAP-1
• Gene ID: 6045
• mRNA Refseq: NM_007212
• Protein Refseq: NP_009143
• MIM: 608985
• UniProt ID: Q99496