Recombinant Human RNF145 Protein, GST-tagged

• Cat.No.: RNF145-4301H
• Product Overview: Human FLJ31951 partial ORF ( NP_653327, 592 a.a. - 691 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: RNF145 (Ring Finger Protein 145) is a Protein Coding gene. An important paralog of this gene is RNF139.
• Molecular Mass: 36.74 kDa
• AA Sequence: WLYVQETCPLCHCHLKNSSQLPGLGTEPVLQPHAGAEQNVMFQEGTEPPGQEHTPGTRIQEGSRDNNEYIARRPDNQEGAFDPKEYPHSAKDEAHPVESA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: RNF145 ring finger protein 145 [ Homo sapiens ]
• Official Symbol: RNF145
• Synonyms: RNF145; ring finger protein 145; FLJ31951
• Gene ID: 153830
• mRNA Refseq: NM_001199380
• Protein Refseq: NP_001186309
• UniProt ID: Q96MT1