Recombinant Human RNF144B protein, His-tagged

• Cat.No.: RNF144B-7686H
• Product Overview: Recombinant Human RNF144B protein(123-187 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: His
• Protein Length: 123-187 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: VADCQTVCPVASSDPGQPVLVECPSCHLKFCSCCKDAWHAEVSCRDSQPIVLPTEHRALFGTDAE
• Purity: 65%, by SDS-PAGE.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: RNF144B ring finger protein 144B [ Homo sapiens ]
• Official Symbol: RNF144B
• Synonyms: RNF144B; ring finger protein 144B; IBR domain containing 2 , IBRDC2; E3 ubiquitin-protein ligase RNF144B; bA528A10.3; IBR domain containing 2; IBR domain-containing protein 2; p53-inducible RING finger protein; PIR2; IBRDC2; p53RFP; KIAA0161; MGC71786
• mRNA Refseq: NM_182757
• Protein Refseq: NP_877434
• UniProt ID: Q7Z419
• Gene ID: 255488