Recombinant Human RNF144A protein, GST-tagged

• Cat.No.: RNF144A-301193H
• Product Overview: Recombinant Human RNF144A (52-179 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Glu52-Asp179
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: ELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFEREVLFDPCRTWCPASTCQAVCQLQDVGLQTPQPVQCKACRMEFCSTCKASWHPGQGCPETMPITFLPGETSAAFKMEEDD
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: RNF144A ring finger protein 144A [ Homo sapiens ]
• Official Symbol: RNF144A
• Synonyms: RNF144A; ring finger protein 144A; ring finger protein 144 , RNF144; probable E3 ubiquitin-protein ligase RNF144A; KIAA0161; UBCE7IP4; UbcM4-interacting protein 4; ubiquitin conjugating enzyme 7 interacting protein 4; ubiquitin-conjugating enzyme 7-interacting protein 4; RNF144
• Gene ID: 9781
• mRNA Refseq: NM_014746
• Protein Refseq: NP_055561
• UniProt ID: P50876