Recombinant Human RNF139 protein, GST-tagged

• Cat.No.: RNF139-301441H
• Product Overview: Recombinant Human RNF139 (511-664 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Gln511-Asp664
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: QAKNGWKTFMNRRTAVKKINSLPEIKGSRLQEINDVCAICYHEFTTSARITPCNHYFHALCLRKWLYIQDTCPMCHQKVYIEDDIKDNSNVSNNNGFIPPNETPEEAVREAAAESDRELNEDDSTDCDDDVQRERNGVIQHTGAAAEEFNDDTD
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: RNF139 ring finger protein 139 [ Homo sapiens ]
• Official Symbol: RNF139
• Synonyms: RNF139; ring finger protein 139; E3 ubiquitin-protein ligase RNF139; HRCA1; RCA1; TRC8; multiple membrane spanning receptor TRC8; patched related protein translocated in renal cancer; translocation in renal carcinoma on chromosome 8 protein; MGC31961
• Gene ID: 11236
• mRNA Refseq: NM_007218
• Protein Refseq: NP_009149
• MIM: 603046
• UniProt ID: Q8WU17