Recombinant Human RNF135 protein, His-tagged

• Cat.No.: RNF135-501H
• Product Overview: Recombinant Human RNF135 protein(NP_001171921)(1-210 aa), fused with His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-210 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• AA Sequence: MAGLGLGSAVPVWLAEDDLGCIICQGLLDWPATLPCGHSFCRHCLEALWGARDARRWACPTCRQGAAQQPHLRKNTLLQDLADKYRRAAREIQAGSDPAHCPCPGSSSLSSAAARPRRRPELQRVAVEKSITEVAQELTELVEHLVDIVRSLQNQRPLSESGPDNELSILGKENSWKPRLPPHAHCLTRATLHSGELLGLLSGPSIQPLT
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: RNF135 ring finger protein 135 [ Homo sapiens ]
• Official Symbol: RNF135
• Synonyms: RNF135; ring finger protein 135; E3 ubiquitin-protein ligase RNF135; MGC13061; riplet; RIG-I E3 ubiquitin ligase; L13; MMFD; REUL; Riplet
• Gene ID: 84282
• mRNA Refseq: NM_001184992
• Protein Refseq: NP_001171921
• MIM: 611358
• UniProt ID: Q8IUD6