Recombinant Human RNF123 protein, His-tagged

• Cat.No.: RNF123-156H
• Product Overview: Recombinant Human RNF123(12-358aa) fused with His tag at N-terminal was expressed in E. coli.

Specification

• Description: The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions.
• Source: E. coli
• Species: Human
• Tag: His
• Form: 2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), added with 300 mM Imidazole and 0.7% sarcosyl, 15% glycerol.
• AA Sequence: RKSYRLTSDAEKSRVTGIVQEKLLNDYLNRIFSSSEHAPPAATSRKPLNFQNLPEHLDQLLQVDNEEEESQGQVE GRLGPSTVVLDHTGGFEGLLLVDDDLLGVIGHSNFGTIRSTTCVYKGKWLYEVLISSQGLMQIGWCTISCRFNQE EGVGDTHNSYAYDGNRVRKWNVTTTNYGKAWAAGDIVSCLIDLDDGTLSFCLNGVSLGTAFENLSRGLGMAYFPA ISLSFKESVAFNFGSRPLRYPVAGYRPLQDPPSADLVRAQRLLGCFRAVLSVELDPVEGRLLDKESSKWRLRGQP TVLLTLAHIFHHFAPLLRKVYLVEAVLMSFLLGIVEKGTPTQAQSVV
• Stability: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
• Storage: Storage of Reconstituted ProteinShort-term storage: Store at 2-8 centigrade for two weeks.Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.Reconstitution with 200 μl 50% glycerol soluAon is recommended for longer term storage (see Stability and Storage for more details).If a different concentraAon is needed for your purposes please adjust the reconsAtuAon volume as required (please note: the ion concentration of the final soluAon will vary according to the volume used).Note: Centrifuge vial before opening. When reconsAtuAng, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into soluAon.
• Protein length: 12-358 a.a.

Gene Information

• Gene Name: RNF123 ring finger protein 123 [ Homo sapiens ]
• Official Symbol: RNF123
• Synonyms: RNF123; ring finger protein 123; E3 ubiquitin-protein ligase RNF123; FLJ12565; kip1 ubiquitination-promoting complex protein 1; KPC1; FP1477; MGC163504; DKFZp686C2222
• Gene ID: 63891
• mRNA Refseq: NM_022064
• Protein Refseq: NP_071347
• MIM: 614472
• UniProt ID: Q5XPI4
• Chromosome Location: 3p24.3
• Pathway: Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination and Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; Immune System, organism-specific biosystem
• Function: ligase activity; metal ion binding; zinc ion binding