Recombinant Human RNF123 protein, His-tagged
Cat.No. : | RNF123-156H |
Product Overview : | Recombinant Human RNF123(12-358aa) fused with His tag at N-terminal was expressed in E. coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 12-358 a.a. |
Description : | The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. |
Form : | 2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), added with 300 mM Imidazole and 0.7% sarcosyl, 15% glycerol. |
AA Sequence : | RKSYRLTSDAEKSRVTGIVQEKLLNDYLNRIFSSSEHAPPAATSRKPLNFQNLPEHLDQLLQVDNEEEESQGQVE GRLGPSTVVLDHTGGFEGLLLVDDDLLGVIGHSNFGTIRSTTCVYKGKWLYEVLISSQGLMQIGWCTISCRFNQE EGVGDTHNSYAYDGNRVRKWNVTTTNYGKAWAAGDIVSCLIDLDDGTLSFCLNGVSLGTAFENLSRGLGMAYFPA ISLSFKESVAFNFGSRPLRYPVAGYRPLQDPPSADLVRAQRLLGCFRAVLSVELDPVEGRLLDKESSKWRLRGQP TVLLTLAHIFHHFAPLLRKVYLVEAVLMSFLLGIVEKGTPTQAQSVV |
Stability : | Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles. |
Storage : | Storage of Reconstituted ProteinShort-term storage: Store at 2-8 centigrade for two weeks.Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.Reconstitution with 200 μl 50% glycerol soluAon is recommended for longer term storage (see Stability and Storage for more details).If a different concentraAon is needed for your purposes please adjust the reconsAtuAon volume as required (please note: the ion concentration of the final soluAon will vary according to the volume used).Note: Centrifuge vial before opening. When reconsAtuAng, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into soluAon. |
Gene Name | RNF123 ring finger protein 123 [ Homo sapiens ] |
Official Symbol | RNF123 |
Synonyms | RNF123; ring finger protein 123; E3 ubiquitin-protein ligase RNF123; FLJ12565; kip1 ubiquitination-promoting complex protein 1; KPC1; FP1477; MGC163504; DKFZp686C2222; |
Gene ID | 63891 |
mRNA Refseq | NM_022064 |
Protein Refseq | NP_071347 |
MIM | 614472 |
UniProt ID | Q5XPI4 |
Chromosome Location | 3p24.3 |
Pathway | Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination and Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; Immune System, organism-specific biosystem; |
Function | ligase activity; metal ion binding; zinc ion binding; |
◆ Recombinant Proteins | ||
RNF123-5585C | Recombinant Chicken RNF123 | +Inquiry |
RNF123-157H | Recombinant Human RNF123 protein, GST-tagged | +Inquiry |
RNF123-14293M | Recombinant Mouse RNF123 Protein | +Inquiry |
RNF123-156H | Recombinant Human RNF123 protein, His-tagged | +Inquiry |
RNF123-7646M | Recombinant Mouse RNF123 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RNF123 Products
Required fields are marked with *
My Review for All RNF123 Products
Required fields are marked with *
0
Inquiry Basket