Recombinant Human RNASE6 protein, His&Myc-tagged
Cat.No. : | RNASE6-5644H |
Product Overview : | Recombinant Human RNASE6 protein(Q93091)(24-150aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | N-His&C-Myc |
ProteinLength : | 24-150aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 19.7 kDa |
AASequence : | WPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDSFQNVAAVCDLLSIVCKNRRHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAAQYKFFIVACDPPQKSDPPYKLVPVHLDSIL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
◆ Recombinant Proteins | ||
BDKRB1-1684HF | Recombinant Full Length Human BDKRB1 Protein, GST-tagged | +Inquiry |
CD70-3055HF | Recombinant Full Length Human CD70 Protein, GST-tagged | +Inquiry |
RSRC1-12196Z | Recombinant Zebrafish RSRC1 | +Inquiry |
Rab21-5297M | Recombinant Mouse Rab21 Protein, Myc/DDK-tagged | +Inquiry |
DAPK2-26805TH | Recombinant Human DAPK2 | +Inquiry |
◆ Native Proteins | ||
VCL-899T | Native Turkey VCL Protein | +Inquiry |
Heart-005H | Human Heart Lysate, Total Protein | +Inquiry |
Collagen Type IV-09H | Native Human Collagen Type IV | +Inquiry |
Ovary-025H | Human Ovary Lysate, Total Protein | +Inquiry |
Lectin-1842S | Active Native Solanum Tuberosum Lectin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
Cotton-690P | Cotton Lysate, Total Protein | +Inquiry |
ETFDH-6530HCL | Recombinant Human ETFDH 293 Cell Lysate | +Inquiry |
KLHL20-943HCL | Recombinant Human KLHL20 cell lysate | +Inquiry |
PRKRIR-2846HCL | Recombinant Human PRKRIR 293 Cell Lysate | +Inquiry |
BAMBI-2393HCL | Recombinant Human BAMBI cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RNASE6 Products
Required fields are marked with *
My Review for All RNASE6 Products
Required fields are marked with *
0
Inquiry Basket