Recombinant Human RNASE2 protein, His-tagged

• Cat.No.: RNASE2-356H
• Product Overview: Recombinant Human RNASE2 protein(P10153)(28-161aa), fused with C-terminal His tag, was expressed in Yeast.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 28-161aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 17.0 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: KPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII

Gene Information

• Gene Name: RNASE2 ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin) [ Homo sapiens ]
• Official Symbol: RNASE2
• Synonyms: RNASE2; ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin); RNS2; non-secretory ribonuclease; EDN; RNase 2; RNase UpI-2; ribonuclease 2; ribonuclease US; eosinophil-derived neurotoxin
• Gene ID: 6036
• mRNA Refseq: NM_002934
• Protein Refseq: NP_002925
• MIM: 131410
• UniProt ID: P10153