Recombinant Human RNASE2 Protein, GST-tagged

• Cat.No.: RNASE2-01H
• Product Overview: Human RNASE2 partial ORF ( NP_002925, 86 a.a. - 161 a.a.) recombinant protein with GST-tag at N-terminal was expressed in wheat germ (in vitro).

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a non-secretory ribonuclease that belongs to the pancreatic ribonuclease family, a subset of the ribonuclease A superfamily. The protein antimicrobial activity against viruses.
• Molecular Mass: 34.1 kDa
• AA Sequence: NMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: RNASE2 ribonuclease A family member 2 [ Homo sapiens (human) ]
• Official Symbol: RNASE2
• Synonyms: RNASE2; ribonuclease A family member 2; EDN; RAF3; RNS2; non-secretory ribonuclease; RNase 2; RNase UpI-2; eosinophil-derived neurotoxin; ribonuclease 2; ribonuclease A F3; ribonuclease US; ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin); EC 4.6.1.18
• Gene ID: 6036
• mRNA Refseq: NM_002934
• Protein Refseq: NP_002925
• MIM: 131410
• UniProt ID: P10153