Recombinant Human RNASE10 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RNASE10-5971H
• Product Overview: RNASE10 MS Standard C13 and N15-labeled recombinant protein (NP_001012993) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: RNASE10 (Ribonuclease A Family Member 10 (Inactive)) is a Protein Coding gene. Diseases associated with RNASE10 include Hypotrichosis 6 and Orchitis. Gene Ontology (GO) annotations related to this gene include nucleic acid binding and ribonuclease activity. An important paralog of this gene is RNASE4.
• Molecular Mass: 24 kDa
• AA Sequence: MKLNLVQIFFMLLMLLLGLGMGLGLGLHMATAVLEESDQPLNEFWSSDSQDKAEATEEGDGTQTTETLVLSNKEVVQPGWPEDPILGEDEVGGNKMLRASALFQSNKDYLRLDQTDRECNDMMAHKMKEPSQSCIAQYAFIHEDLNTVKAVCNSPVIACELKGGKCHKSSRPFDLTLCELSQPDQVTPNCNYLTSVIKKHIIITCNDMKRQLPTGQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RNASE10 ribonuclease A family member 10 (inactive) [ Homo sapiens (human) ]
• Official Symbol: RNASE10
• Synonyms: RNASE10; ribonuclease A family member 10 (inactive); RAH1; RNASE9; inactive ribonuclease-like protein 10; ribonuclease A H1; ribonuclease, RNase A family, 10 (non-active)
• Gene ID: 338879
• mRNA Refseq: NM_001012975
• Protein Refseq: NP_001012993
• UniProt ID: Q5GAN6