Recombinant Human RIT1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RIT1-6153H
• Product Overview: RIT1 MS Standard C13 and N15-labeled recombinant protein (NP_008843) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a member of a subfamily of Ras-related GTPases. The encoded protein is involved in regulating p38 MAPK-dependent signaling cascades related to cellular stress. This protein also cooperates with nerve growth factor to promote neuronal development and regeneration. Alternate splicing results in multiple transcript variants.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 25.1 kDa
• AA Sequence: MDSGTRPVGSCCSSPAGLSREYKLVMLGAGGVGKSAMTMQFISHRFPEDHDPTIEDAYKIRIRIDDEPANLDILDTAGQAEFTAMRDQYMRAGEGFIICYSITDRRSFHEVREFKQLIYRVRRTDDTPVVLVGNKSDLKQLRQVTKEEGLALAREFSCPFFETSAAYRYYIDDVFHALVREIRRKEKEAVLAMEKKSKPKNSVWKRLKSPFRKKKDSVTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RIT1 Ras-like without CAAX 1 [ Homo sapiens (human) ]
• Official Symbol: RIT1
• Synonyms: RIT1; Ras-like without CAAX 1; Ric (Drosophila) like, expressed in many tissues, RIT; GTP-binding protein Rit1; GTP binding protein Roc1; MGC125864; MGC125865; RIBB; Ric like; expressed in many tissues; ROC1; GTP-binding protein Roc1; ras-like without CAAX protein 1; Ric-like, expressed in many tissues; ras-like protein expressed in many tissues; RIT
• Gene ID: 6016
• mRNA Refseq: NM_006912
• Protein Refseq: NP_008843
• MIM: 609591
• UniProt ID: Q92963