Recombinant Human RIPPLY3 Protein, GST-tagged

• Cat.No.: RIPPLY3-2886H
• Product Overview: Human DSCR6 full-length ORF ( NP_061835.1, 1 a.a. - 190 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: RIPPLY3 (Ripply Transcriptional Repressor 3) is a Protein Coding gene. Diseases associated with RIPPLY3 include Velocardiofacial Syndrome.
• Molecular Mass: 46.8 kDa
• AA Sequence: MEPEAAAGARKARGRGCHCPGDAPWRPPPPRGPESPAPWRPWIQTPGDAELTRTGRPLEPRADQHTFGSKGAFGFQHPVRVYLPMSKRQEYLRSSGEQVLASFPVQATIDFYDDESTESASEAEEPEEGPPPLHLLPQEVGGRQENGPGGKGRDQGINQGQRSSGGGDHWGEGPLPQGVSSRGGKCSSSK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: RIPPLY3 ripply transcriptional repressor 3 [ Homo sapiens (human) ]
• Official Symbol: RIPPLY3
• Synonyms: RIPPLY3; ripply transcriptional repressor 3; Ripply Transcriptional Repressor 3; Down Syndrome Critical Region Protein 6; Down Syndrome Critical Region Gene 6; DSCR6; Ripply3 Homolog (Zebrafish); Protein Ripply3; Ripply3 Homolog; protein ripply3; Down syndrome critical region gene 6; down syndrome critical region protein 6; ripply3 homolog
• Gene ID: 53820
• mRNA Refseq: NM_001317768
• Protein Refseq: NP_001304697
• MIM: 609892
• UniProt ID: P57055