Recombinant Human RIPK3

• Cat.No.: RIPK3-29985TH
• Product Overview: Recombinant fragment corresponding to amino acids 418-518 of Human RIP3 with a propreitary tag at N-terminal; predicted mwt: 36.74 kDa.

Specification

• Description: The product of this gene is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases, and contains a C-terminal domain unique from other RIP family members. The encoded protein is predominantly localized to the cytoplasm, and can undergo nucleocytoplasmic shuttling dependent on novel nuclear localization and export signals. It is a component of the tumor necrosis factor (TNF) receptor-I signaling complex, and can induce apoptosis and weakly activate the NF-kappaB transcription factor.
• Protein length: 101 amino acids
• Molecular Weight: 36.740kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Highly expressed in the pancreas. Detected at lower levels in heart, placenta, lung and kidney. Isoform 3 is significantly increased in colon and lung cancers.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: SPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK
• Sequence Similarities: Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family.Contains 1 protein kinase domain.
• Tag: Non

Gene Information

• Gene Name: RIPK3 receptor-interacting serine-threonine kinase 3 [ Homo sapiens ]
• Official Symbol: RIPK3
• Synonyms: RIPK3; receptor-interacting serine-threonine kinase 3; receptor-interacting serine/threonine-protein kinase 3; RIP3
• Gene ID: 11035
• mRNA Refseq: NM_006871
• Protein Refseq: NP_006862
• MIM: 605817
• Uniprot ID: Q9Y572
• Chromosome Location: 14q12
• Pathway: Cytosolic DNA-sensing pathway, organism-specific biosystem; Cytosolic DNA-sensing pathway, conserved biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem
• Function: ATP binding; NF-kappaB-inducing kinase activity; nucleotide binding; protein binding; protein kinase activity