Recombinant Human RHOXF2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RHOXF2-3948H
• Product Overview: RHOXF2 MS Standard C13 and N15-labeled recombinant protein (NP_115887) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene, which encodes a transcriptional repressor, is one of two paralogous X-linked homeobox-containing genes and is highly expressed in a variety of cancers. In addition, the encoded protein associates with the cell membrane and with microtubules, and is concentrated at the leading edge of migratory cells.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 31.7 kDa
• AA Sequence: MEPPDQCSQYMTSLLSPAVDDEKELQDMNAMVLSLTEEVKEEEEDAQPEPEQGTAAGEKLKSAGAQGGEEKDGGGEEKDGGGAGVPGHLWEGDLEGTSGSDGNVEDSDQSEKEPGQQYSRPQGAVGGLEPGNAQQPNVHAFTPLQLQELERIFQREQFPSEFLRRRLARSMNVTELAVQIWFENRRAKWRRHQRALMARNMLPFMAVGQPVMVTAAEAITAPLFISGMRDDYFWDHSHSSSLCFPMPPFPPPSLPLPLMLLPPMPPAGQAEFGPFPFVIVPSFTFPNVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RHOXF2 Rhox homeobox family member 2 [ Homo sapiens (human) ]
• Official Symbol: RHOXF2
• Synonyms: RHOXF2; Rhox homeobox family, member 2; rhox homeobox family member 2; cancer/testis antigen 107; CT107; PEPP 2; PEPP2; THG1; PEPP subfamily gene 2; testis homeobox gene 1; homeobox protein from AL590526; paired-like homeobox protein PEPP-2; PEPP-2
• Gene ID: 84528
• mRNA Refseq: NM_032498
• Protein Refseq: NP_115887
• MIM: 300447
• UniProt ID: Q9BQY4