Recombinant Human RHOU protein, GST-tagged

• Cat.No.: RHOU-301420H
• Product Overview: Recombinant Human RHOU (127-220 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization
• Protein length: Cys127-Val220
• AA Sequence: CFSVVSPSSFQNVSEKWVPEIRCHCPKAPIILVGTQSDLREDVKVLIELDKCKEKPVPEEAAKLCAEEIKAASYIECSALTQKNLKEVFDAAIV
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: RHOU ras homolog family member U [ Homo sapiens ]
• Official Symbol: RHOU
• Synonyms: RHOU; ras homolog family member U; ARHU, ras homolog gene family, member U; rho-related GTP-binding protein RhoU; 2310026M05Rik; CDC42 like GTPase; CDC42L1; DJ646B12.2; fJ646B12.2; FLJ10616; GTP binding protein like 1; GTP binding protein SB128; hG28K; ras like gene family member U; Ryu GTPase; Wnt 1 responsive Cdc42 homolog; WRCH 1; WRCH1; CDC42-like GTPase 1; GTP-binding protein SB128; GTP-binding protein like 1; rho GTPase-like protein ARHU; ras-like gene family member U; wnt-1 responsive Cdc42 homolog 1; ras homolog gene family, member U; ARHU
• Gene ID: 58480
• mRNA Refseq: NM_021205
• Protein Refseq: NP_067028
• MIM: 606366
• UniProt ID: Q7L0Q8