Recombinant Human RGS2 protein, T7-tagged
Cat.No. : | RGS2-190H |
Product Overview : | Recombinant human RGS2 (211 aa) protein fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 211 a.a. |
Form : | 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGEFGSMQSAMFLAVQHDCRPMDKSAGSGHKSEEKREKMKRTLLKDWKTRLSYFLQNSSTPGKP KTGKKSKQQAFIKPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFKKTKSPQKLSSKAR KIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSLMENNSYPRFLESEFYQDLCKKPQITTEP HAT |
Purity : | >90% by SDS-PAGE. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | RGS2 regulator of G-protein signaling 2, 24kDa [ Homo sapiens ] |
Official Symbol | RGS2 |
Synonyms | RGS2; regulator of G-protein signaling 2, 24kDa; G0S8, regulator of G protein signalling 2, 24kD , regulator of G protein signalling 2, 24kDa; G0S8; |
Gene ID | 5997 |
mRNA Refseq | NM_002923 |
Protein Refseq | NP_002914 |
MIM | 600861 |
UniProt ID | P41220 |
Chromosome Location | 1q31 |
Pathway | Calcium Regulation in the Cardiac Cell, organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; Myometrial Relaxation and Contraction Pathways, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by GPCR, organism-specific biosystem; |
Function | GTPase activator activity; calmodulin binding; protein binding; |
◆ Recombinant Proteins | ||
RGS2-3875R | Recombinant Rhesus monkey RGS2 Protein, His-tagged | +Inquiry |
RGS2-4677R | Recombinant Rat RGS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RGS2-4015H | Recombinant Human RGS2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RGS2-5018R | Recombinant Rat RGS2 Protein | +Inquiry |
RGS2-5965C | Recombinant Chicken RGS2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RGS2-2378HCL | Recombinant Human RGS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RGS2 Products
Required fields are marked with *
My Review for All RGS2 Products
Required fields are marked with *
0
Inquiry Basket