Recombinant Human RGP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RGP1-629H
• Product Overview: RGP1 MS Standard C13 and N15-labeled recombinant protein (NP_001073965) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The RIC1-RGP1 complex acts as a guanine nucleotide exchange factor (GEF), which activates RAB6A by exchanging bound GDP for free GTP and may thereby required for efficient fusion of endosome-derived vesicles with the Golgi compartment. The RIC1-RGP1 complex participates in the recycling of mannose-6-phosphate receptors.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 42.46 kDa
• AA Sequence: MIEVVAELSRGPVFLAGEALECVVTVTNPLPPTATSASSEALAWASAQIHCQFHASESRVALPPPDSSQPDVQPDSQTVFLPHRGERGQCILSTPPKILFCDLRLDPGESKSYSYSEVLPIEGPPSFRGQSVKYVYKLTIGCQRVNSPITLLRVPLRVLVLTGLQDVRFPQDEAVAPSSPFLEEDEGGKKDSWLAELAGERLMAATSCRSLHLYNISDGRGKVGTFGIFKSVYRLGEDVVGTLNLGEGTVACLQFSVSLQTEERVQPEYQRRRGAGGVPSVSHVTHARHQESCLHTTRTSFSLPIPLSSTPGFCTAIVSLKWRLHFEFVTSREPGLVLLPPVEQPEPTTWTGPEQVPVDTFSWDLPIKVLPTSPTLASYAAPGPSTSTITITRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RGP1 RGP1 homolog, RAB6A GEF complex partner 1 [ Homo sapiens (human) ]
• Official Symbol: RGP1
• Synonyms: RGP1; RGP1 homolog, RAB6A GEF complex partner 1; KIAA0258; RAB6A-GEF complex partner protein 2; RGP1 retrograde golgi transport homolog; retrograde Golgi transport protein RGP1 homolog
• Gene ID: 9827
• mRNA Refseq: NM_001080496
• Protein Refseq: NP_001073965
• MIM: 615742
• UniProt ID: Q92546