Recombinant Human RGN, His-tagged

Cat.No. : RGN-30488TH
Product Overview : Recombinant full length Human Regucalcin with an N terminal His tag; 319 amino acids with the tag; mwt: 35.4 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 299 amino acids
Description : The protein encoded by this gene is a highly conserved, calcium-binding protein, that is preferentially expressed in the liver and kidney. It may have an important role in calcium homeostasis. Studies in rat indicate that this protein may also play a role in aging, as it shows age-associated down-regulation. This gene is part of a gene cluster on chromosome Xp11.3-Xp11.23. Alternative splicing results in two transcript variants having different 5 UTRs, but encoding the same protein.
Conjugation : HIS
Molecular Weight : 35.400kDa inclusive of tags
Form : Liquid
Purity : by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 1.2% Urea
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMSSIKIECVLPENCRCGESPVWEEVSNSLLFVDIPAKKVCRWDSFTKQVQRVTMDAPVSSVALRQSGGYVATIGTKFCALNWKEQSAVVLATVDNDKKNNRFNDGKVDPAGRYFAGTMAEETAPAVLERHQGALYSLFPDHHVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYSVDAFDYDLQTGQISNRRSVYKLEKEEQIPDGMCIDAEGKLWVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGMDPEGLLRQPEAGG IFKITGLGVKGIAPYSYAG
Sequence Similarities : Belongs to the SMP-30/CGR1 family.
Gene Name RGN regucalcin (senescence marker protein-30) [ Homo sapiens ]
Official Symbol RGN
Synonyms RGN; regucalcin (senescence marker protein-30); regucalcin; RC; senescence marker protein 30; SMP30;
Gene ID 9104
mRNA Refseq NM_004683
Protein Refseq NP_004674
MIM 300212
Uniprot ID Q15493
Chromosome Location Xp11.3
Pathway Ascorbate and aldarate metabolism, organism-specific biosystem; Ascorbate and aldarate metabolism, conserved biosystem; Ascorbate biosynthesis, animals, glucose-1P => ascorbate, organism-specific biosystem; Ascorbate biosynthesis, animals, glucose-1P =>
Function calcium ion binding; calcium ion binding; enzyme regulator activity; gluconolactonase activity; hydrolase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RGN Products

Required fields are marked with *

My Review for All RGN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon