Recombinant Human RGN, His-tagged

• Cat.No.: RGN-30488TH
• Product Overview: Recombinant full length Human Regucalcin with an N terminal His tag; 319 amino acids with the tag; mwt: 35.4 kDa.

Specification

• Description: The protein encoded by this gene is a highly conserved, calcium-binding protein, that is preferentially expressed in the liver and kidney. It may have an important role in calcium homeostasis. Studies in rat indicate that this protein may also play a role in aging, as it shows age-associated down-regulation. This gene is part of a gene cluster on chromosome Xp11.3-Xp11.23. Alternative splicing results in two transcript variants having different 5 UTRs, but encoding the same protein.
• Protein length: 299 amino acids
• Conjugation: HIS
• Molecular Weight: 35.400kDa inclusive of tags
• Source: E. coli
• Form: Liquid
• Purity: by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 1.2% Urea
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMSSIKIECVLPENCRCGESPVWEEVSNSLLFVDIPAKKVCRWDSFTKQVQRVTMDAPVSSVALRQSGGYVATIGTKFCALNWKEQSAVVLATVDNDKKNNRFNDGKVDPAGRYFAGTMAEETAPAVLERHQGALYSLFPDHHVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYSVDAFDYDLQTGQISNRRSVYKLEKEEQIPDGMCIDAEGKLWVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGMDPEGLLRQPEAGG IFKITGLGVKGIAPYSYAG
• Sequence Similarities: Belongs to the SMP-30/CGR1 family.

Gene Information

• Gene Name: RGN regucalcin (senescence marker protein-30) [ Homo sapiens ]
• Official Symbol: RGN
• Synonyms: RGN; regucalcin (senescence marker protein-30); regucalcin; RC; senescence marker protein 30; SMP30
• Gene ID: 9104
• mRNA Refseq: NM_004683
• Protein Refseq: NP_004674
• MIM: 300212
• Uniprot ID: Q15493
• Chromosome Location: Xp11.3
• Pathway: Ascorbate and aldarate metabolism, organism-specific biosystem; Ascorbate and aldarate metabolism, conserved biosystem; Ascorbate biosynthesis, animals, glucose-1P => ascorbate, organism-specific biosystem; Ascorbate biosynthesis, animals, glucose-1P =>
• Function: calcium ion binding; calcium ion binding; enzyme regulator activity; gluconolactonase activity; hydrolase activity