Recombinant Human RFTN2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RFTN2-4541H
Product Overview : RFTN2 MS Standard C13 and N15-labeled recombinant protein (NP_653230) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : RFTN2 (Raftlin Family Member 2) is a Protein Coding gene. Diseases associated with RFTN2 include Glass Syndrome. An important paralog of this gene is RFTN1.
Source : HEK293
Species : Human
Tag : Myc&DDK
Molecular Mass : 55.9 kDa
AA Sequence : MGCGLRKLEDPDDSSPGKIFSTLKRPQVETKTEFAYEYVLLDFTLQASSNPEVIKINSILDIVTKVENYYLKGYIVGAIHPVIQPVGQRKHLPASYLYRVVLLRLKLSPKNSAAPSGQRRPRLVIEECPLTSEAQTNDAAKELIEKINVAAKRGMKFVGFISQHYSPSKFCNGTNHDGDIESMLHVRHGSDENCRSWNEGTLSGQSSESGIEEELHHESGQYQMEQNGSPTSSKSRKGEASDNKLYTVFNAFDDDSTSWAYQEGILSMKVTRKGSVISTLDADWLELTTFYYKQGLSLIDSFVFWETSKGEHLPKSLEGFFIYEEEGSGVPGSSRKGNDAIVVEQWTVIEGCEIKTDYGPLLHTLAEFGWLLTSVLPTPVLRHDSEGNLATKQIVFLQRPVMWNSAAQTPDKKASRHIKGEDKNKATSRSIGLDTTSSQPAESRHLPEECRLSPSRECWTKEGRLAQHNSFSGFSSSDNVLRELDDGQFDQEDGVTQVTCMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RFTN2 raftlin family member 2 [ Homo sapiens (human) ]
Official Symbol RFTN2
Synonyms RFTN2; raftlin family member 2; C2orf11, chromosome 2 open reading frame 11; raftlin-2; FLJ30574; Raftlin 2; raft-linking protein 2; C2orf11; Raftlin-2; MGC117313;
Gene ID 130132
mRNA Refseq NM_144629
Protein Refseq NP_653230
MIM 618215
UniProt ID Q52LD8

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RFTN2 Products

Required fields are marked with *

My Review for All RFTN2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon