Recombinant Human RFC5 protein, His-tagged

• Cat.No.: RFC5-3337H
• Product Overview: Recombinant Human RFC5 protein(219-341 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 219-341 aa
• AA Sequence: ILQSTNMAFGKVTEETVYTCTGHPLKSDIANILDWMLNQDFTTAYRNITELKTLKGLALHDILTEIHLFVHRVDFPSSVRIHLLTKMADIEYRLSVGTNEKIQLSSLIAAFQVTRDLIVAEA
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: RFC5 replication factor C (activator 1) 5, 36.5kDa [ Homo sapiens ]
• Official Symbol: RFC5
• Synonyms: RFC5; replication factor C (activator 1) 5, 36.5kDa; replication factor C (activator 1) 5 (36.5kD); replication factor C subunit 5; RFC36; A1 36 kDa subunit; RF-C 36 kDa subunit; RFC, 36.5 kD subunit; replication factor C, 36-kDa subunit; MGC1155
• Gene ID: 5985
• mRNA Refseq: NM_001130112
• Protein Refseq: NP_001123584
• MIM: 600407
• UniProt ID: P40937