Recombinant Human RFC5 protein, His-tagged
Cat.No. : | RFC5-3337H |
Product Overview : | Recombinant Human RFC5 protein(219-341 aa), fused to His tag, was expressed in E. coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 219-341 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | ILQSTNMAFGKVTEETVYTCTGHPLKSDIANILDWMLNQDFTTAYRNITELKTLKGLALHDILTEIHLFVHRVDFPSSVRIHLLTKMADIEYRLSVGTNEKIQLSSLIAAFQVTRDLIVAEA |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | RFC5 replication factor C (activator 1) 5, 36.5kDa [ Homo sapiens ] |
Official Symbol | RFC5 |
Synonyms | RFC5; replication factor C (activator 1) 5, 36.5kDa; replication factor C (activator 1) 5 (36.5kD); replication factor C subunit 5; RFC36; A1 36 kDa subunit; RF-C 36 kDa subunit; RFC, 36.5 kD subunit; replication factor C, 36-kDa subunit; MGC1155; |
Gene ID | 5985 |
mRNA Refseq | NM_001130112 |
Protein Refseq | NP_001123584 |
MIM | 600407 |
UniProt ID | P40937 |
◆ Recombinant Proteins | ||
RFC5-1699H | Recombinant Human RFC5 protein, His & T7-tagged | +Inquiry |
RFC5-6754H | Recombinant Human RFC5 protein, His-tagged | +Inquiry |
RFC5-01H | Recombinant Human RFC5 Protein, GST-tagged | +Inquiry |
RFC5-1149Z | Recombinant Zebrafish RFC5 | +Inquiry |
RFC5-3859R | Recombinant Rhesus monkey RFC5 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RFC5-2409HCL | Recombinant Human RFC5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RFC5 Products
Required fields are marked with *
My Review for All RFC5 Products
Required fields are marked with *
0
Inquiry Basket