Recombinant Human RFC1 Protein (402-492 aa), His-Myc-tagged

• Cat.No.: RFC1-2807H
• Product Overview: Recombinant Human RFC1 Protein (402-492 aa) is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial.

Specification

• Description: The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins PCNA and activator 1. This subunit binds to the primer-template junction. Binds the PO-B transcription element as well as other GA rich DNA sequences. Could play a role in DNA transcription regulation as well as DNA replication and/or repair. Can bind single- or double-stranded DNA. Interacts with C-terminus of PCNA. 5' phosphate residue is required for binding of the N-terminal DNA-binding domain to duplex DNA, suggesting a role in recognition of non-primer template DNA structures during replication and/or repair.
• Source: Baculovirus
• Species: Human
• Tag: His&Myc
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 13.8 kDa
• Protein length: 402-492 aa
• AA Sequence: GAENCLEGLIFVITGVLESIERDEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTKIIDEDGLLNLIRTMPGKKSKYEIA
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: RFC1 replication factor C (activator 1) 1, 145kDa [ Homo sapiens ]
• Official Symbol: RFC1
• Synonyms: RFC1; A1; MHCBFB; PO GA; RFC140; A1 140 kDa subunit; RF-C 140 kDa subunit; RFC; PO-GA; RECC1; MGC51786
• Gene ID: 5981
• mRNA Refseq: NM_001204747
• Protein Refseq: NP_001191676
• MIM: 102579
• UniProt ID: P35251