Recombinant Human RFC1 Protein (402-492 aa), His-Myc-tagged

Cat.No. : RFC1-2807H
Product Overview : Recombinant Human RFC1 Protein (402-492 aa) is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His&Myc
Protein Length : 402-492 aa
Description : The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins PCNA and activator 1. This subunit binds to the primer-template junction. Binds the PO-B transcription element as well as other GA rich DNA sequences. Could play a role in DNA transcription regulation as well as DNA replication and/or repair. Can bind single- or double-stranded DNA. Interacts with C-terminus of PCNA. 5' phosphate residue is required for binding of the N-terminal DNA-binding domain to duplex DNA, suggesting a role in recognition of non-primer template DNA structures during replication and/or repair.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 13.8 kDa
AA Sequence : GAENCLEGLIFVITGVLESIERDEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTKIIDEDGLLNLIRTMPGKKSKYEIA
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name RFC1 replication factor C (activator 1) 1, 145kDa [ Homo sapiens ]
Official Symbol RFC1
Synonyms RFC1; A1; MHCBFB; PO GA; RFC140; A1 140 kDa subunit; RF-C 140 kDa subunit; RFC; PO-GA; RECC1; MGC51786;
Gene ID 5981
mRNA Refseq NM_001204747
Protein Refseq NP_001191676
MIM 102579
UniProt ID P35251

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RFC1 Products

Required fields are marked with *

My Review for All RFC1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon