Recombinant Human REXO1, His-tagged
Cat.No. : | REXO1-31126TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 773-1221 of Human REXO1 with N terminal His tag; Predicted MWt 51 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | 773-1221 a.a. |
Description : | REXO1 or Elongin A-binding protein 1 (EloA-BP1) is an exonuclease domain-containing protein that can bind to Elongin. The Elongin complex stimulates the rate of transcription elongation by RNA polymerase II by suppressing the transient pausing of the polymerase at many sites along the DNA template. REXO1 is composed of 1221 amino acids and its mRNA is ubiquitously expressed. EloA-BP1 is capable of binding not only the NH(2)-terminal approximately 120 amino acid region of Elongin A, but also that of SII. Although REXO1 had no detectable effect on the rate of transcription elongation in vitro, it may play some role in the regulation of elongation in vivo. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 107 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | RTLSGMASKTTTTIIPKRIAHSPSLQSLKKPIIPKEFGGK VPTVIRQRYLNLFIEECLKFCTSNQEAIEKALNEEKVA YDRSPSKNIYLNVAVNTLKKLRGLAPSAVPGLSKTSGR RVVSHEVVLGGRLAAKTSFSLSRPSSPRVEDLKGAALY SRLREYLLTQDQLKENGYPFPHPERPGGAIIFTAEEKRPK DSSCRTCCRCGTEYLVSSSGRCIRDEECYYHWGRLRRN RVAGGWETQYMCCSAAAGSVGCQVAKQHVQDGRKERLE GFVKTFEKELSGDTHPGIYALDCEMSYTTYGLELTRVT VVDTDVHVVYDTFVKPDNEIVDYNTRFSGVTEADLADT SVTLRDVQAVLLSMFSADTILIGHSLESDLLALKVIHSTV VDTSVLFPHRLGLPYKRSLRNLMADYLRQIIQDNVDGH SSSEDAGACMHLVIWKVREDAKTKR |
Gene Name | REXO1 REX1, RNA exonuclease 1 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | REXO1 |
Synonyms | REXO1; REX1, RNA exonuclease 1 homolog (S. cerevisiae); TCEB3BP1, transcription elongation factor B polypeptide 3 binding protein 1; RNA exonuclease 1 homolog; EloA BP1; elongin A binding protein 1; KIAA1138; |
Gene ID | 57455 |
mRNA Refseq | NM_020695 |
Protein Refseq | NP_065746 |
MIM | 609614 |
Uniprot ID | Q8N1G1 |
Chromosome Location | 19p13.3 |
Pathway | Ribosome biogenesis in eukaryotes, organism-specific biosystem; Ribosome biogenesis in eukaryotes, conserved biosystem; |
Function | exonuclease activity; hydrolase activity; nucleic acid binding; |
◆ Recombinant Proteins | ||
SLC41A3-4294R | Recombinant Rhesus monkey SLC41A3 Protein, His-tagged | +Inquiry |
CCL5-312R | Recombinant Rat CCL5 protein, His-tagged | +Inquiry |
RFL16431HF | Recombinant Full Length Human Atp Synthase Subunit F, Mitochondrial(Atp5J2) Protein, His-Tagged | +Inquiry |
FABP4-4423HF | Recombinant Full Length Human FABP4 Protein, GST-tagged | +Inquiry |
Spike-339V | Recombinant COVID-19 Spike RBD (K444R) protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1868W | Active Native Wisteria Floribunda Lectin Protein, Agarose bound | +Inquiry |
Lectin-1732D | Active Native Dolichos Biflorus Agglutinin Protein, Rhodamine labeled | +Inquiry |
Histone-52C | Native Calf Histone | +Inquiry |
IBVT5399-230I | Native nfluenza (B/Tokio/53/99) IBVT5399 protein | +Inquiry |
Proteasome 26S-38H | Native Human Proteasome 26S Protein, Tag Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZCCHC3-1964HCL | Recombinant Human ZCCHC3 cell lysate | +Inquiry |
ZNF333-2013HCL | Recombinant Human ZNF333 cell lysate | +Inquiry |
CCDC82-7746HCL | Recombinant Human CCDC82 293 Cell Lysate | +Inquiry |
EPSTI1-6574HCL | Recombinant Human EPSTI1 293 Cell Lysate | +Inquiry |
PPID-2972HCL | Recombinant Human PPID 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All REXO1 Products
Required fields are marked with *
My Review for All REXO1 Products
Required fields are marked with *
0
Inquiry Basket