Recombinant Human RER1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RER1-1220H
• Product Overview: RER1 MS Standard C13 and N15-labeled recombinant protein (NP_008964) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene is a multi-pass membrane protein that is localized to the golgi apparatus. It is involved in the retention of endoplasmic reticulum (ER) membrane proteins in the ER and retrieval of ER membrane proteins from the early Golgi compartment to facilitate gamma-secretase complex assembly.
• Molecular Mass: 23 kDa
• AA Sequence: MSEGDSVGESVHGKPSVVYRFFTRLGQIYQSWLDKSTPYTAVRWVVTLGLSFVYMIRVYLLQGWYIVTYALGIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFKFWHAATKGILVAMVCTFFDAFNVPVFWPILVMYFIMLFCITMKRQIKHMIKYRYIPFTHGKRRYRGKEDAGKAFASTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RER1 retention in endoplasmic reticulum sorting receptor 1 [ Homo sapiens (human) ]
• Official Symbol: RER1
• Synonyms: RER1; retention in endoplasmic reticulum sorting receptor 1; protein RER1; RER1 retention in endoplasmic reticulum 1 homolog
• Gene ID: 11079
• mRNA Refseq: NM_007033
• Protein Refseq: NP_008964
• UniProt ID: O15258