Recombinant Human REM1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: REM1-4906H
• Product Overview: REM1 MS Standard C13 and N15-labeled recombinant protein (NP_054731) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene is a GTPase and member of the RAS-like GTP-binding protein family. The encoded protein is expressed in endothelial cells, where it promotes reorganization of the actin cytoskeleton and morphological changes in the cells.
• Molecular Mass: 32.9 kDa
• AA Sequence: MTLNTEQEAKTPLHRRASTPLPLSPRGHQPGRLSTVPSTQSQHPRLGQSASLNPPTQKPSPAPDDWSSESSDSEGSWEALYRVVLLGDPGVGKTSLASLFAGKQERDLHEQLGEDVYERTLTVDGEDTTLVVVDTWEAEKLDKSWSQESCLQGGSAYVIVYSIADRGSFESASELRIQLRRTHQADHVPIILVGNKADLARCREVSVEEGRACAVVFDCKFIETSATLQHNVAELFEGVVRQLRLRRRDSAAKEPPAPRRPASLAQRARRFLARLTARSARRRALKARSKSCHNLAVLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: REM1 RRAD and GEM like GTPase 1 [ Homo sapiens (human) ]
• Official Symbol: REM1
• Synonyms: REM1; RAS (RAD and GEM)-like GTP-binding 1; RAS (RAD and GEM) like GTP binding, REM; GTP-binding protein REM 1; GES; GTPase GES; rad and Gem-like GTP-binding protein 1; GTPase-regulating endothelial cell sprouting; REM; GD:REM; MGC48669
• Gene ID: 28954
• mRNA Refseq: NM_014012
• Protein Refseq: NP_054731
• MIM: 610388
• UniProt ID: O75628