Recombinant Human REG4 Protein, His-tagged
Cat.No. : | REG4-424H |
Product Overview : | Recombinant human REG4 protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 158 |
Description : | Enables heparin binding activity and mannan binding activity. Predicted to act upstream of or within response to bacterium. Located in cytoplasm. |
Form : | Lyophilized |
Molecular Mass : | 16.7 kDa |
AA Sequence : | MASRSMRLLLLLSCLAKTGVLGDIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | REG4 regenerating islet-derived family, member 4 [ Homo sapiens (human) ] |
Official Symbol | REG4 |
Synonyms | REG4; regenerating islet-derived family, member 4; regenerating islet-derived protein 4; gastrointestinal secretory protein; GISP; REG IV; regenerating gene type IV; RELP; REG-4; reg IV; REG-like protein; regenerating islet-derived protein IV; REG-IV; |
Gene ID | 83998 |
mRNA Refseq | NM_001159352 |
Protein Refseq | NP_001152824 |
MIM | 609846 |
UniProt ID | Q9BYZ8 |
◆ Recombinant Proteins | ||
REG4-314H | Recombinant Human REG4, Fc tagged | +Inquiry |
REG4-4650R | Recombinant Rat REG4 Protein, His (Fc)-Avi-tagged | +Inquiry |
REG4-637H | Recombinant Human REG4 protein, hFc-tagged | +Inquiry |
REG4-424H | Recombinant Human REG4 Protein, His-tagged | +Inquiry |
REG4-302H | Recombinant Human REG4 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
REG4-001HCL | Recombinant Human REG4 cell lysate | +Inquiry |
REG4-979HCL | Recombinant Human REG4 cell lysate | +Inquiry |
REG4-2111MCL | Recombinant Mouse REG4 cell lysate | +Inquiry |
REG4-1328RCL | Recombinant Rat REG4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All REG4 Products
Required fields are marked with *
My Review for All REG4 Products
Required fields are marked with *
0
Inquiry Basket