Recombinant Human REG4 Protein, His-tagged

• Cat.No.: REG4-424H
• Product Overview: Recombinant human REG4 protein with His tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• ProteinLength: 158
• Description: Enables heparin binding activity and mannan binding activity. Predicted to act upstream of or within response to bacterium. Located in cytoplasm.
• Form: Lyophilized
• Molecular Mass: 16.7 kDa
• AA Sequence: MASRSMRLLLLLSCLAKTGVLGDIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQSYGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: REG4 regenerating islet-derived family, member 4 [ Homo sapiens (human) ]
• Official Symbol: REG4
• Synonyms: REG4; regenerating islet-derived family, member 4; regenerating islet-derived protein 4; gastrointestinal secretory protein; GISP; REG IV; regenerating gene type IV; RELP; REG-4; reg IV; REG-like protein; regenerating islet-derived protein IV; REG-IV
• Gene ID: 83998
• mRNA Refseq: NM_001159352
• Protein Refseq: NP_001152824
• MIM: 609846
• UniProt ID: Q9BYZ8