Recombinant Human REEP6 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : REEP6-4435H
Product Overview : REEP6 MS Standard C13 and N15-labeled recombinant protein (NP_612402) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene may be involved in the transport of receptors from the endoplasmic reticulum (ER) to the cell surface. The encoded protein may also play a role in regulating ER membrane structure. This gene is required for the proper development of retinal rods and photoreceptors, with defects in this gene being associated with retinitis pigmentosa 77.
Molecular Mass : 20.7 kDa
AA Sequence : MDGLRQRVEHFLEQRNLVTEVLGALEAKTGVEKRYLAAGAVTLLSLYLLFGYGASLLCNLIGFVYPAYASIKAIESPSKDDDTVWLTYWVVYALFGLAEFFSDLLLSWFPFYYVGKCAFLLFCMAPRPWNGALMLYQRVVRPLFLRHHGAVDRIMNDLSGRALDAAAGITRNVKPSQTPQPKDKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name REEP6 receptor accessory protein 6 [ Homo sapiens (human) ]
Official Symbol REEP6
Synonyms REEP6; receptor accessory protein 6; C19orf32, chromosome 19 open reading frame 32; receptor expression-enhancing protein 6; deleted in polyposis 1 like 1; DP1L1; FLJ25383; polyposis locus protein 1 like 1; deleted in polyposis 1-like 1; polyposis locus protein 1-like 1; receptor expression enhancing protein 6; TB2L1; C19orf32;
Gene ID 92840
mRNA Refseq NM_138393
Protein Refseq NP_612402
MIM 609346
UniProt ID Q96HR9

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All REEP6 Products

Required fields are marked with *

My Review for All REEP6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon