Recombinant Full Length Bovine Receptor Expression-Enhancing Protein 6(Reep6) Protein, His-Tagged
Cat.No. : | RFL30825BF |
Product Overview : | Recombinant Full Length Bovine Receptor expression-enhancing protein 6(REEP6) Protein (Q32LG5) (1-185aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-185) |
Form : | Lyophilized powder |
AA Sequence : | MDGLRQRFERFLEQRNLATEALGALEAKTGVDKRYLATGAATLLSLYLLFGYGAPLLCSL IGFAYPAYASIKAIESPSKEDDTVWLTYWVVYGLFGLAEFFSDLLLSWFPFYYAGKCAFL LFCMAPGPWNGAHMLYHRIIRPLFLKHHEAVDSIVSDISGRALDVAAGMTKDAGKVSVNQ LQKAK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | REEP6 |
Synonyms | REEP6; Receptor expression-enhancing protein 6 |
UniProt ID | Q32LG5 |
◆ Recombinant Proteins | ||
REEP6-3660R | Recombinant Rhesus Macaque REEP6 Protein, His (Fc)-Avi-tagged | +Inquiry |
REEP6-4645R | Recombinant Rat REEP6 Protein, His (Fc)-Avi-tagged | +Inquiry |
REEP6-1369Z | Recombinant Zebrafish REEP6 | +Inquiry |
RFL30825BF | Recombinant Full Length Bovine Receptor Expression-Enhancing Protein 6(Reep6) Protein, His-Tagged | +Inquiry |
REEP6-3843R | Recombinant Rhesus monkey REEP6 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
REEP6-2425HCL | Recombinant Human REEP6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All REEP6 Products
Required fields are marked with *
My Review for All REEP6 Products
Required fields are marked with *
0
Inquiry Basket