Recombinant Human REEP6 protein, GST-tagged

• Cat.No.: REEP6-301254H
• Product Overview: Recombinant Human REEP6 (1-184 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met1-Lys184
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MDGLRQRVEHFLEQRNLVTEVLGALEAKTGVEKRYLAAGAVTLLSLYLLFGYGASLLCNLIGFVYPAYASIKAIESPSKDDDTVWLTYWVVYALFGLAEFFSDLLLSWFPFYYVGKCAFLLFCMAPRPWNGALMLYQRVVRPLFLRHHGAVDRIMNDLSGRALDAAAGITRNVKPSQTPQPKDK
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: REEP6 receptor accessory protein 6 [ Homo sapiens ]
• Official Symbol: REEP6
• Synonyms: REEP6; receptor accessory protein 6; C19orf32, chromosome 19 open reading frame 32; receptor expression-enhancing protein 6; deleted in polyposis 1 like 1; DP1L1; FLJ25383; polyposis locus protein 1 like 1; deleted in polyposis 1-like 1; polyposis locus protein 1-like 1; receptor expression enhancing protein 6; TB2L1; C19orf32
• Gene ID: 92840
• mRNA Refseq: NM_138393
• Protein Refseq: NP_612402
• MIM: 609346
• UniProt ID: Q96HR9