Recombinant Human REEP5 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: REEP5-631H
• Product Overview: REEP5 MS Standard C13 and N15-labeled recombinant protein (NP_005660) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: May promote functional cell surface expression of olfactory receptors.
• Molecular Mass: 21.3 kDa
• AA Sequence: MSAAMRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISIKAIESPNKEDDTQWLTYWVVYGVFSIAEFFSDIFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKSTSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: REEP5 receptor accessory protein 5 [ Homo sapiens (human) ]
• Official Symbol: REEP5
• Synonyms: REEP5; receptor accessory protein 5; C5orf18, chromosome 5 open reading frame 18; receptor expression-enhancing protein 5; D5S346; deleted in polyposis 1; DP1; polyposis coli region hypothetical protein DP1; polyposis locus protein 1; TB2; receptor expression enhancing protein 5; YOP1; C5orf18; MGC70440
• Gene ID: 7905
• mRNA Refseq: NM_005669
• Protein Refseq: NP_005660
• MIM: 125265
• UniProt ID: Q00765