Recombinant Human REEP5 Protein, GST-Tagged

• Cat.No.: REEP5-1327H
• Product Overview: Human C5orf18 partial ORF (NP_005660, 113 a.a. - 184 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: REEP5 (Receptor Accessory Protein 5) is a Protein Coding gene. Among its related pathways are Signaling by GPCR and Olfactory Signaling Pathway. An important paralog of this gene is REEP6.
• Molecular Mass: 33.66 kDa
• AA Sequence: KCGFLLWCMAPSPSNGAELLYKRIIRPFFLKHESQMDSVVKDLKDKAKETADAITKEAKKATVNLLGEEKKS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: REEP5 receptor accessory protein 5 [ Homo sapiens ]
• Official Symbol: REEP5
• Synonyms: REEP5; receptor accessory protein 5; C5orf18, chromosome 5 open reading frame 18; receptor expression-enhancing protein 5; D5S346; deleted in polyposis 1; DP1; polyposis coli region hypothetical protein DP1; polyposis locus protein 1; TB2; receptor expression enhancing protein 5; YOP1; C5orf18; MGC70440
• Gene ID: 7905
• mRNA Refseq: NM_005669
• Protein Refseq: NP_005660
• MIM: 125265
• UniProt ID: Q00765