Recombinant Human REEP2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: REEP2-505H
• Product Overview: REEP2 MS Standard C13 and N15-labeled recombinant protein (NP_057690) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a member of the receptor expression enhancing protein family. Studies of a related gene in mouse suggest that the encoded protein is found in the cell membrane and enhances the function of sweet taste receptors. Alternative splicing results in multiple transcript variants.
• Molecular Mass: 28.3 kDa
• AA Sequence: MVSWIISRLVVLIFGTLYPAYSSYKAVKTKNVKEYVKWMMYWIVFAFFTTAETLTDIVLSWFPFYFELKIAFVIWLLSPYTKGSSVLYRKFVHPTLSNKEKEIDEYITQARDKSYETMMRVGKRGLNLAANAAVTAAAKGVLSEKLRSFSMQDLTLIRDEDALPLQRPDGRLRPSPGSLLDTIEDLGDDPALSLRSSTNPADSRTEASEDDMGDKAPKRAKPIKKAPKAEPLASKTLKTRPKKKTSGGGDSATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: REEP2 receptor accessory protein 2 [ Homo sapiens (human) ]
• Official Symbol: REEP2
• Synonyms: REEP2; receptor accessory protein 2; C5orf19, chromosome 5 open reading frame 19; receptor expression-enhancing protein 2; SGC32445; receptor expression enhancing protein 2; C5orf19
• Gene ID: 51308
• mRNA Refseq: NM_016606
• Protein Refseq: NP_057690
• MIM: 609347
• UniProt ID: Q9BRK0