Recombinant Human RDRC protein, GST-tagged

• Cat.No.: RDRC-2241H
• Product Overview: Recombinant Human RDRC (C-106aa) fussed with GST tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: C-106aa
• Form: 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), 100 mM GSH and 1% Triton X-100, 15% glycerol.
• Molecular Mass: 38 kDa
• AA Sequence: VLTLAIILEAVNLPVDHISLILAVDWLVDRSCTVLNVEGDALGAGLLQNYVDRTESRSTEPELIQVKSELPLDPL PLPTEEGNPLLKHYRGPAGDATVASEKESVM
• Stability: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
• Shipping: The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.

Gene Information

• Gene Name: SLC1A5 solute carrier family 1 (neutral amino acid transporter), member 5 [ Homo sapiens ]
• Official Symbol: SLC1A5
• Synonyms: SLC1A5; solute carrier family 1 (neutral amino acid transporter), member 5; M7V1, RDRC; neutral amino acid transporter B(0); AAAT; ASCT2; ATB(0); RD114 virus receptor; baboon M7 virus receptor; neutral amino acid transporter B; solute carrier family 1 member 5; RD114/simian type D retrovirus receptor; sodium-dependent neutral amino acid transporter type 2; R16; ATBO; M7V1; RDRC; M7VS1; FLJ31068
• Gene ID: 6510
• mRNA Refseq: NM_001145144
• Protein Refseq: NP_001138616
• MIM: 109190
• UniProt ID: Q15758
• Chromosome Location: 19q13.3
• Pathway: Amino acid transport across the plasma membrane, organism-specific biosystem; Protein digestion and absorption, organism-specific biosystem; Protein digestion and absorption, conserved biosystem; SLC-mediated transmembrane transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Transport of inorganic cations/anions and amino acids/oligopeptides, organism-specific biosystem
• Function: L-glutamine transmembrane transporter activity; neutral amino acid transmembrane transporter activity; receptor activity; sodium:dicarboxylate symporter activity; symporter activity